HORDB

ID: hor000241
Uniprot ID: A0A7M7IUS5
Protein name: Pigment dispersing factor
Gene name: NA
Organism: Nasonia vitripennis (Parasitic wasp)
Family: Arthropod PDH family
Source: Animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0009416 response to light stimulus
GO CC: GO:0005576 extracellular region

Sequence: NSELINSLLSLPKNMNNA
Length: 18(62-79)
Propeptide: MRSWVSHLIRAFFVFGAILCASASMEDTSHMIMNNPYGRSLDAELITRLLLAPQRLCHPKRNSELINSLLSLPKNMNNAGK
Signal peptide: MRSWVSHLIRAFFVFGAILCASA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000241_AF2.pdb

hor000241_ESM.pdb

Mass:	227565	Formula:	C83H142N24O29S
Absent amino acids:	CDFGHQRTVWY	Common amino acids:	N
pI:	6.41	Basic residues:	1
Polar residues:	8	Hydrophobic residues:	6
Hydrophobicity:	-30.56	Boman Index:	-2700
Half-Life / Aliphatic Index:	1.4 hour	Aliphatic Index:	113.89
Instability Index:	2984.44	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 20695486
Title: Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis