General Information

  • ID:  hor000241
  • Uniprot ID:  A0A7M7IUS5
  • Protein name:  Pigment dispersing factor
  • Gene name:  NA
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSELINSLLSLPKNMNNA
  • Length:  18(62-79)
  • Propeptide:  MRSWVSHLIRAFFVFGAILCASASMEDTSHMIMNNPYGRSLDAELITRLLLAPQRLCHPKRNSELINSLLSLPKNMNNAGK
  • Signal peptide:  MRSWVSHLIRAFFVFGAILCASA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7IUS5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000241_AF2.pdbhor000241_ESM.pdb

Physical Information

Mass: 227565 Formula: C83H142N24O29S
Absent amino acids: CDFGHQRTVWY Common amino acids: N
pI: 6.41 Basic residues: 1
Polar residues: 8 Hydrophobic residues: 6
Hydrophobicity: -30.56 Boman Index: -2700
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 113.89
Instability Index: 2984.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis